PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0226700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 96aa    MW: 10656 Da    PI: 9.1864
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0226700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-172269148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT eEd+ lv++++  G g W+t ar  g++Rt+k+c++rw++yl
  ORGLA05G0226700.1 22 KGPWTMEEDLSLVNYIAANGEGAWNTLARAAGLNRTGKSCRLRWLNYL 69
                       79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0881773IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-211872IPR009057Homeodomain-like
SMARTSM007173.5E-112171IPR001005SANT/Myb domain
PfamPF002496.7E-152269IPR001005SANT/Myb domain
SuperFamilySSF466893.04E-212396IPR009057Homeodomain-like
CDDcd001671.13E-82469No hitNo description
Gene3DG3DSA:1.10.10.601.9E-67396IPR009057Homeodomain-like
PROSITE profilePS512947.2457496IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MQYTVEGSGG GGVQTVEAAV RKGPWTMEED LSLVNYIAAN GEGAWNTLAR AAGLNRTGKS  60
CRLRWLNYLR PDVRRGNITP EEHTLIVELQ ARWGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-13149619100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1209861e-82AC120986.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1781_H11, complete sequence.
GenBankAC1209901e-82AC120990.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0040E06, complete sequence.
GenBankAP0149611e-82AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639020.19e-65PREDICTED: transcription factor MYB21
SwissprotP813912e-44MYB05_ANTMA; Myb-related protein 305
SwissprotQ9LK954e-44MYB21_ARATH; Transcription factor MYB21
TrEMBLI1PY196e-65I1PY19_ORYGL; Uncharacterized protein
TrEMBLQ0DFV39e-65Q0DFV3_ORYSJ; Os05g0568200 protein
STRINGLOC_Os05g49310.13e-64(Oryza sativa Japonica Group)
STRINGORGLA05G0226700.12e-64(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-45myb domain protein 21